PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022956.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 458aa    MW: 51609.4 Da    PI: 6.1059
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022956.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS432.82.6e-132444521374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA +v+sg+ e+a+  L +  +laspdgd+mqR+aayfteALa r+++  ++l kal++++ s  ++see+ +++lf++++P+lk++++++
  Pbr022956.1  44 LIQLLYACASHVASGSIENANIWLDQTCQLASPDGDSMQRIAAYFTEALADRMLKGLPGLHKALNSTKIS--SVSEEILVQRLFFDLCPFLKVAYVVT 139
                  689*************************************************************999998..6************************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  N+aI+ea+ege++vHiiD+   +++QW++L+q+L++Rpegpp+lRiTg+++    +ke l ++  rL++ Ae+l++pf+fn+ ++++le+l++e+Lrv
  Pbr022956.1 140 NRAIVEAMEGEKMVHIIDLHSCEPAQWINLIQTLNARPEGPPHLRITGIHE----QKEVLDQMFLRLTEEAENLNIPFQFNA-IVSKLENLDIESLRV 232
                  ***************************************************....9**************************.7999*********** PP

         GRAS 197 kpgEalaVnlvlqlhrll...........................................desvsles.erdevLklvkslsPkvvvvveqeadhns 250
                  k+gEalaV+++lqlh+ll                                            +++s++s +  ++L  +++lsPk++v++eqea+hn+
  Pbr022956.1 233 KTGEALAVCSILQLHSLLasdddrrrktpasknlqkvlhmnkltlgewlekdpingspdsaLSPLSSASpKMGSFLTSLWGLSPKLMVITEQEANHNG 330
                  **********************************************************9984444444446778************************ PP

         GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg 348
                  +++++r++eal++y alfd+le++++r   er+kvE+ l+g+ei+n++aceg+er+erhe+lekW  rle aGF+ vpls++ + qa  llr ++  g
  Pbr022956.1 331 HTLMDRIMEALYFYGALFDCLESTVSRSPMERQKVEKLLFGEEIKNIIACEGTERTERHEKLEKWILRLELAGFGRVPLSYNGMLQATELLRGYD--G 426
                  **********************************************************************************************9..* PP

         GRAS 349 yrveeesgslvlgWkdrpLvsvSaWr 374
                  y+++e +g++v++W+drpL+s+S Wr
  Pbr022956.1 427 YKIKEYNGCVVICWHDRPLFSISGWR 452
                  *************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.96918434IPR005202Transcription factor GRAS
PfamPF035148.9E-13044452IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MAQEDGSPVT SSALQFFPWL SPGIGSPYSP WLRELKSEER GLCLIQLLYA CASHVASGSI  60
ENANIWLDQT CQLASPDGDS MQRIAAYFTE ALADRMLKGL PGLHKALNST KISSVSEEIL  120
VQRLFFDLCP FLKVAYVVTN RAIVEAMEGE KMVHIIDLHS CEPAQWINLI QTLNARPEGP  180
PHLRITGIHE QKEVLDQMFL RLTEEAENLN IPFQFNAIVS KLENLDIESL RVKTGEALAV  240
CSILQLHSLL ASDDDRRRKT PASKNLQKVL HMNKLTLGEW LEKDPINGSP DSALSPLSSA  300
SPKMGSFLTS LWGLSPKLMV ITEQEANHNG HTLMDRIMEA LYFYGALFDC LESTVSRSPM  360
ERQKVEKLLF GEEIKNIIAC EGTERTERHE KLEKWILRLE LAGFGRVPLS YNGMLQATEL  420
LRGYDGYKIK EYNGCVVICW HDRPLFSISG WRFRRYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-43444524375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009354422.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WZE40.0M5WZE4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s06090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3